Skip to content
We supply businesses and institutions only. No sales to individuals, and no dosing or usage advice.
UK Master Peptides
Menu
Trade accountRequest a quote
FOXO4-DRI 10 mg vial, labelled for research use only

FOXO4-DRI 10 mgBox code F410

Pre-order: delivered within 14 days of confirmation. Nothing is charged when you pre-order.

Pre-order
Research gradePre-order

FOXO4-DRI, research grade

FOXO4-DRI is a synthetic peptide of 46 D-amino acids, built in the reverse order (D-retro-inverso): residues 92 to 124 of human FOXO4 and a sequence from the HIV-1 TAT protein, joined by three prolines. Supplied to verified research buyers only.

For laboratory research use only. Not for human or veterinary use. Not a medicine.

Pre-orderRequest a quoteWho can buy research-grade products
Pack
Box of 10 vials
Box codes
F410
Label
For laboratory research use only. Not for human or veterinary use.

Identity

NameFOXO4-DRI (also FOXO4 D-retro-inverso peptide)
Sequence, three-letterD-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly
Sequence, one-letterltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg
Length46 amino acids
Molecular formulaC₂₂₈H₃₈₈N₈₆O₆₄
Molecular weight5358 g/mol (monoisotopic mass 5354.975)

Reference data from PubChem (CID 167312269). Sequence checked against UniProt P98177. Check any certificate's mass with our peptide mass calculator.

Specification and supply

StrengthBox codePackAvailability
10 mgF410Box of 10 vialsPre-order

Form: freeze-dried (lyophilised) powder.

Documents and storage

Every batch ships with the manufacturer's certificate of analysis. Ask for the certificate of the current batch before you order. Safety data sheet: on request. Keep the vial tightly closed, dry and at the labelled temperature; our storage and handling guide explains why.

Ordering for institutions

  • Quotations within one working day, valid for 14 days, with lead time and delivery terms on one page.
  • Invoices and documents in your institution's name; tell us if your purchase order needs to appear on them.
  • Payment in full before dispatch, unless other terms are agreed in writing.
  • Every shipment carries the batch number and expiry on the packing list and delivery note.

Who can buy it

Verified research buyers only, with a signed end-use declaration: laboratory research by qualified staff, no use in people or animals, no resale for those uses. We give no dosing or usage advice.

Related: All research-grade products · How to read a certificate of analysis

Questions people ask

Is FOXO4-DRI in stock?

Not in UK stock at the moment. You can pre-order it: nothing is charged when you pre-order, and we deliver within 14 days of confirming it.

Can individuals buy FOXO4-DRI from you?

No. We supply verified research buyers only.