Identity
| Name | PNC-27 |
| Sequence, three-letter | Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly |
| Sequence, one-letter | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
| Length | 32 amino acids |
| Molecular formula | C₁₈₈H₂₉₃N₅₃O₄₄S |
| Molecular weight | 4032 g/mol (monoisotopic mass 4029.204) |
Reference data from PubChem (CID 16201774). Sequence checked against UniProt P04637. Check any certificate's mass with our peptide mass calculator.
Specification and supply
| Strength | Box code | Pack | Availability |
|---|---|---|---|
| 5 mg | PNC5 | Box of 10 vials | Pre-order |
Form: freeze-dried (lyophilised) powder.
Documents and storage
Every batch ships with the manufacturer's certificate of analysis. Ask for the certificate of the current batch before you order. Safety data sheet: on request. Keep the vial tightly closed, dry and at the labelled temperature; our storage and handling guide explains why.
Ordering for institutions
- Quotations within one working day, valid for 14 days, with lead time and delivery terms on one page.
- Invoices and documents in your institution's name; tell us if your purchase order needs to appear on them.
- Payment in full before dispatch, unless other terms are agreed in writing.
- Every shipment carries the batch number and expiry on the packing list and delivery note.
Who can buy it
Verified research buyers only, with a signed end-use declaration: laboratory research by qualified staff, no use in people or animals, no resale for those uses. We give no dosing or usage advice.
Related: All research-grade products · How to read a certificate of analysis
Questions people ask
- Is PNC-27 in stock?
Not in UK stock at the moment. You can pre-order it: nothing is charged when you pre-order, and we deliver within 14 days of confirming it.
- Can individuals buy PNC-27 from you?
No. We supply verified research buyers only.