Skip to content
We supply businesses and institutions only. No sales to individuals, and no dosing or usage advice.
UK Master Peptides
Menu
Trade accountRequest a quote
Sermorelin 5 mg vial, labelled for research use only

Sermorelin acetate 5 mgBox code SMO5

Pre-order: delivered within 14 days of confirmation. Nothing is charged when you pre-order.

Pre-order
Research gradePre-order

Sermorelin acetate, research grade

Sermorelin is a synthetic peptide of 29 amino acids, the first 29 residues of human growth hormone-releasing hormone with an amidated C-terminus, supplied as the acetate salt. Supplied to verified research buyers only.

For laboratory research use only. Not for human or veterinary use. Not a medicine.

Pre-orderRequest a quoteWho can buy research-grade products
Pack
Box of 10 vials
Box codes
SMO5 · SMO10
Label
For laboratory research use only. Not for human or veterinary use.

Identity

NameSermorelin acetate (also sermorelin, GRF (1-29) amide)
Sequence, three-letterTyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂
Sequence, one-letterYADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂
Length29 amino acids
Molecular formulaC₁₄₉H₂₄₆N₄₄O₄₂S
Molecular weight3357.9 g/mol (monoisotopic mass 3355.8187)
CAS number86168-78-7

Reference data from PubChem (CID 16132413). Check any certificate's mass with our peptide mass calculator.

Specification and supply

StrengthBox codePackAvailability
5 mgSMO5Box of 10 vialsPre-order
10 mgSMO10Box of 10 vialsPre-order

Form: freeze-dried (lyophilised) powder.

Documents and storage

Every batch ships with the manufacturer's certificate of analysis. Ask for the certificate of the current batch before you order. Safety data sheet: on request. Keep the vial tightly closed, dry and at the labelled temperature; our storage and handling guide explains why.

Ordering for institutions

  • Quotations within one working day, valid for 14 days, with lead time and delivery terms on one page.
  • Invoices and documents in your institution's name; tell us if your purchase order needs to appear on them.
  • Payment in full before dispatch, unless other terms are agreed in writing.
  • Every shipment carries the batch number and expiry on the packing list and delivery note.

Who can buy it

Verified research buyers only, with a signed end-use declaration: laboratory research by qualified staff, no use in people or animals, no resale for those uses. We give no dosing or usage advice.

Related: All research-grade products · How to read a certificate of analysis

Questions people ask

What is the Sermorelin acetate sequence?

Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂ (YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂), 29 amino acids.

What is the CAS number of Sermorelin acetate?

86168-78-7 (PubChem).

Is Sermorelin acetate in stock?

Not in UK stock at the moment. You can pre-order it: nothing is charged when you pre-order, and we deliver within 14 days of confirming it.

Can individuals buy Sermorelin acetate from you?

No. We supply verified research buyers only.