Identity
| Name | VIP |
| Sequence, three-letter | His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂ |
| Sequence, one-letter | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ |
| Length | 28 amino acids |
| Molecular formula | C₁₄₇H₂₃₈N₄₄O₄₂S |
| Molecular weight | 3325.80 g/mol (monoisotopic mass 3323.7561) |
| CAS number | 40077-57-4 |
Formula and masses calculated from the sequence. Sequence checked against UniProt P01282. Check any certificate's mass with our peptide mass calculator.
Specification and supply
| Strength | Box code | Pack | Availability |
|---|---|---|---|
| 5 mg | VIP5 | Box of 10 vials | Pre-order |
| 10 mg | VIP10 | Box of 10 vials | Pre-order |
Form: freeze-dried (lyophilised) powder.
Documents and storage
Every batch ships with the manufacturer's certificate of analysis. Ask for the certificate of the current batch before you order. Safety data sheet: on request. Keep the vial tightly closed, dry and at the labelled temperature; our storage and handling guide explains why.
Ordering for institutions
- Quotations within one working day, valid for 14 days, with lead time and delivery terms on one page.
- Invoices and documents in your institution's name; tell us if your purchase order needs to appear on them.
- Payment in full before dispatch, unless other terms are agreed in writing.
- Every shipment carries the batch number and expiry on the packing list and delivery note.
Who can buy it
Verified research buyers only, with a signed end-use declaration: laboratory research by qualified staff, no use in people or animals, no resale for those uses. We give no dosing or usage advice.
Related: All research-grade products · How to read a certificate of analysis
Questions people ask
- What is the VIP sequence?
His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂ (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂), 28 amino acids.
- What is the CAS number of VIP?
40077-57-4 (PubChem).
- Is VIP in stock?
Not in UK stock at the moment. You can pre-order it: nothing is charged when you pre-order, and we deliver within 14 days of confirming it.
- Can individuals buy VIP from you?
No. We supply verified research buyers only.